Home Puzzles 2188: Revisiting Puzzle 147: Rosetta Decoy 10

2188: Revisiting Puzzle 147: Rosetta Decoy 10

0
2188: Revisiting Puzzle 147: Rosetta Decoy 10

[ad_1]

puzzle picture

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Status: Active

Name: 2188: Revisiting Puzzle 147: Rosetta Decoy 10
Status: Active
Created: 08/18/2022
Points: 100
Expires: 08/25/2022 – 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is a part of a signaling pathway that regulates sporulation in B. subtilis; the beginning construction is a mannequin produced by Rosetta. We are revisiting previous Foldit puzzles so we are able to see how helpful the latest additions to the sport have been and to offer newer gamers with puzzles which are nonetheless scientifically related.

Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Categories: Overall, Prediction

Need this puzzle? Log in to obtain.
 

[ad_2]

LEAVE A REPLY

Please enter your comment!
Please enter your name here