Home Puzzles 2179: Electron Density Reconstruction 11

2179: Electron Density Reconstruction 11

0

[ad_1]

puzzle picture

2179: Electron Density Reconstruction 11

Standing: Energetic

Identify: 2179: Electron Density Reconstruction 11
Standing: Energetic
Created: 07/28/2022
Factors: 100
Expires: 08/04/2022 – 18:00
Issue: Novice
Description: The construction of this protein has already been solved and printed, however shut inspection means that there are some issues with the printed answer. We would wish to see if Foldit gamers can use the identical electron density information to reconstruct a greater mannequin. Along with the protein chain, puzzle features a glutathione ligand that’s fastened in place.

Sequence:


KELVLVLYDYQEKSPREVTVKKGDILTLLNSTNKDWWKVEVDDRQGFIPAAYLKKLD

Classes: Electron Density, General, Prediction

Want this puzzle? Log in to obtain.
 

[ad_2]

LEAVE A REPLY

Please enter your comment!
Please enter your name here