Home Puzzles 2194: Revisiting Puzzle 148: Rosetta Decoy 11

2194: Revisiting Puzzle 148: Rosetta Decoy 11

0
2194: Revisiting Puzzle 148: Rosetta Decoy 11

[ad_1]

puzzle picture

2194: Revisiting Puzzle 148: Rosetta Decoy 11

Status: Active

Name: 2194: Revisiting Puzzle 148: Rosetta Decoy 11
Status: Active
Created: 09/01/2022
Points: 100
Expires: 09/07/2022 – 16:00
Difficulty: Novice
Description: Note: This puzzle closes a day early, on September 7, attributable to a scheduled Foldit replace.

This is a throwback puzzle to the early days of Foldit. This small protein is a part of the key histocompatibility complicated (MHC) which is important to a functioning immune system. The beginning construction is a Rosetta mannequin. This protein accommodates two cysteine residues which might be oxidized to kind one disulfide bond. We are revisiting outdated Foldit puzzles so we will see how helpful the latest additions to the sport have been and to supply newer gamers with issues which might be nonetheless scientifically related.

Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Categories: Overall, Prediction

Need this puzzle? Log in to obtain.
 

No feedback but.

[ad_2]

LEAVE A REPLY

Please enter your comment!
Please enter your name here