Home Puzzles 2185: Revisiting Puzzle 146: Rosetta Decoy 9

2185: Revisiting Puzzle 146: Rosetta Decoy 9

0
2185: Revisiting Puzzle 146: Rosetta Decoy 9

[ad_1]

puzzle picture

2185: Revisiting Puzzle 146: Rosetta Decoy 9

Status: Active

Name: 2185: Revisiting Puzzle 146: Rosetta Decoy 9
Status: Active
Created: 08/11/2022
Points: 100
Expires: 08/18/2022 – 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in a number of metabolic pathways; the beginning construction is a mannequin produced by Rosetta. We are revisiting previous Foldit puzzles so we will see how helpful the current additions to the sport have been and to offer newer gamers with issues which are scientifically related.

Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Categories: Overall, Prediction

Need this puzzle? Log in to obtain.
 

No feedback but.

[ad_2]

LEAVE A REPLY

Please enter your comment!
Please enter your name here