Home Puzzles 2182: Revisiting Puzzle 144: Rosetta Decoy 8

2182: Revisiting Puzzle 144: Rosetta Decoy 8

0
2182: Revisiting Puzzle 144: Rosetta Decoy 8

[ad_1]

puzzle picture

2182: Revisiting Puzzle 144: Rosetta Decoy 8

Standing: Lively

Identify: 2182: Revisiting Puzzle 144: Rosetta Decoy 8
Standing: Lively
Created: 08/03/2022
Factors: 100
Expires: 08/11/2022 – 18:00
Issue: Novice
Description: It is a throwback puzzle to the early days of Foldit. The perform of this thermophilic protein is unknown, however it’s uncommon amongst intracellular proteins in that the native construction contains disulfide bonds. This protein incorporates six cysteine residues which can be oxidized to type three disulfide bonds. We’re revisiting previous Foldit puzzles so we are able to see how helpful the current additions to the sport have been.

Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Classes: Total, Prediction

Want this puzzle? Log in to obtain.
 

No feedback but.

[ad_2]

LEAVE A REPLY

Please enter your comment!
Please enter your name here